Rat Ig gamma-1 chain C region, His tag
SKU: 86338277998

Rat Ig gamma-1 chain C region, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Ig gamma-1 chain C region, His tagProduct Specification Species Rat Accession P20759 Amino Acid Sequence Protein sequence (P20759, Ala1 Lys326, with C 10*His)

Product Specification


Species Rat
Accession P20759
Amino Acid Sequence

Protein sequence (P20759, Ala1-Lys326, with C-10*His) AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSVSELPILHQDWLNGRTFRCKVTSAAFPSPIEKTISKPEGRTQVPHVYTMSPTKEEMTQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 37.6 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Ig gamma-1 chain C region (IGHG1) is considered an emerging prognostic marker. The upregulation of IGHG1 is strongly associated with various malignancies, including colorectal cancer, gastric cancer, prostate cancer, papillary thyroid carcinoma, leukemia, ovarian cancer, and breast cancer. In colorectal cancer, the upregulation of IGHG1 contributes to increased cellular proliferation. MEK-FECH signaling is upregulated in IGHG1-overexpressing colorectal carcinomas. IGHG1 overexpression has also been reported for the induction of epithelial to mesenchymal cell transmission (EMT) in gastric cancer via tumor growth factor beta (TGF-β)/SMAD3 signaling. In prostate cancer, the inhibition of IGHG1 is linked to the suppression of MEK/ERK/c-Myc signaling, leading to reduced malignant growth. The increased expression of IGHG1 in breast cancer cells activates AKT and vascular endothelial growth factor (VEGF) signaling, leading to enhanced cell proliferation, invasion, and angiogenesis. IGHG1-silencing can suppress the neoplastic characteristics of breast cancer cells in vitro and suppresses tumor growth in nude mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86338277998

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 578 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Erin Clark
Birmingham, US
★★★★★ 5
most convenient refill system
Scent: Ocean Breeze (2 Pack), Scent: Ocean Breeze (2 Pack)
I have been a fan of J.R. Watkins for a while, but these foaming hand soap refills have really sold me on the brand. I get compliments from guests almost every time they use the guest bathroom. The refill process is incredibly easy and mess-free. The spout is designed perfectly so you don't end up with wasted soap running down the side of the bottle, which has been a frustration of mine with other brands. The foam itself is rich and it doesn't just turn into water the second you rub your hands together. I love that I can reuse my dispensers while saving money and reducing plastic waste by buying the larger refill pouches. If you enjoy a high-quality foaming lather and an upscale scent, this is a perfect 5-star household staple.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2026
J
Verified Purchase
JustAShopper
Charlottesville, US
★★★★★ 5
Good hand soap for the price
Scent: Lemon
Great value for the price. The lemon scent smells fresh and clean without being overpowering, and the foaming soap works really well. I like that it’s alcohol-free and made with plant-based cleansers, so it feels gentle on the hands and doesn’t dry them out. The 2-pack refill size lasts a long time, which makes it even more worth it. Overall, a good buy for everyday use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
B
Verified Purchase
BG
Whiting, US
★★★★★ 5
The best foaming soap. Doesn't dry out my hands
Scent: Lemon
I wash my hands many times a day and found that every other foaming soap I used was drying out my hands pretty bad. I found this at Target one day and gave it a try. No more dry hands! I bought a couple Oxo foaming soap dispensers and have been using this soap for a couple years now. The lather is thick and the soap cleans my hands well without drying them out...which was a major problem with every brand I tried previously. It also smells good, but not strong (I usually buy fragrance-free products, but this doesn't bother me at all).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
G
Verified Purchase
GREGORY MECH
Houston, US
★★★★★ 5
Rinses beautifully without drying or residue.
Scent: Rosewater (2 Pack)
The people who post videos of the refill soap being "pure water" apparently don't realize the soap also needs the FOAMING soap dispenser in order to turn this soap into foaming soap. God Bless America! Yes, these items almost always leak when shipped, but usually not enough to return the item. The best scents are Lemon, Desert Rose, Peppermint, and Rosewater. I have been using these lightly scented foaming soaps for almost two decades. They clean and rinse beautifully with no residue. Perfect for my OCD. They never dry my hands out in the winter, regardless of how many times I wash. The refill bottles are usually an excellent value when on sale. Highly recommended! This foaming soap specifically needs a foaming soap dispenser. It specifically says that on the back of the package. For those complaining it’s a liquid and stays liquid, perhaps you’re using just a regular pump container.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
E
Verified Purchase
Ed
Phoenix, US
★★★★★ 4
Wonderful smell and feel. Price could be cheaper
Scent: Ocean Breeze (2 Pack)
Wonderful scent. very easy those with sensitive skin and noses. Feels wonderful on my skin for long. My one and only complaint is that It's pricey.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products