Rat Ig gamma-1 chain C region, His tag
SKU: 90730583304

Rat Ig gamma-1 chain C region, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Ig gamma-1 chain C region, His tagProduct Specification Species Rat Accession P20759 Amino Acid Sequence Protein sequence (P20759, Ala1 Lys326, with C 10*His)

Product Specification


Species Rat
Accession P20759
Amino Acid Sequence

Protein sequence (P20759, Ala1-Lys326, with C-10*His) AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSVSELPILHQDWLNGRTFRCKVTSAAFPSPIEKTISKPEGRTQVPHVYTMSPTKEEMTQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 37.6 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Ig gamma-1 chain C region (IGHG1) is considered an emerging prognostic marker. The upregulation of IGHG1 is strongly associated with various malignancies, including colorectal cancer, gastric cancer, prostate cancer, papillary thyroid carcinoma, leukemia, ovarian cancer, and breast cancer. In colorectal cancer, the upregulation of IGHG1 contributes to increased cellular proliferation. MEK-FECH signaling is upregulated in IGHG1-overexpressing colorectal carcinomas. IGHG1 overexpression has also been reported for the induction of epithelial to mesenchymal cell transmission (EMT) in gastric cancer via tumor growth factor beta (TGF-β)/SMAD3 signaling. In prostate cancer, the inhibition of IGHG1 is linked to the suppression of MEK/ERK/c-Myc signaling, leading to reduced malignant growth. The increased expression of IGHG1 in breast cancer cells activates AKT and vascular endothelial growth factor (VEGF) signaling, leading to enhanced cell proliferation, invasion, and angiogenesis. IGHG1-silencing can suppress the neoplastic characteristics of breast cancer cells in vitro and suppresses tumor growth in nude mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90730583304

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 286 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jordan Marie
Cuba, US
★★★★★ 4
aesthetically pleasing
Color: White, Number Of Shelves: 5, Size: 16in, Color: White, Number Of Shelves: 5, Size: 16in
the shelves were smaller than expected, but the quality is pretty good. if you have a drill, it’s pretty easy to hang them. I would recommend these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
C
Verified Purchase
Connie
Phoenix, US
★★★★★ 5
Great
Color: White, Number Of Shelves: 5, Size: 16in
A little bit smaller than I was expecting but good shelves. They hold up great and are easy to install.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
B
Verified Purchase
Brady
Alexandria, US
★★★★★ 5
Great addition to my home.
Color: Brown, Number Of Shelves: 8, Size: 16in
This 8-piece set of floating shelves from RICHER HOUSE is a fantastic way to add both style and extra storage. The design is sleek and minimalist, giving the illusion that the shelves are floating. The set comes in a variety of sizes, which is great for creating a custom arrangement. The quality is good; the boards are sturdy and the included hardware feels solid. The biggest challenge is the installation. It can be a little tricky to get them perfectly level and flush with the wall, but once they're up, they feel secure. For the value for money, you get a lot of shelves for the price, making them a great option for a budget-friendly home decor refresh.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 10, 2025
T
Verified Purchase
ThatOneGuy
Waukegan, US
★★★★★ 5
Perfect for collectors
Color: White, Number Of Shelves: 5, Size: 16in, Color: White, Number Of Shelves: 5, Size: 16in
Perfect for displaying Pokemon and other sports card products. Holds ETBs and booster packs. Includes stronger knockoff anchors, though I I didn't even use them since the stuff I placed on top is light weight. Shelfs are made of MDF with a nice durable melamine finish. Keep in mind due to its width it does not have 16" OC holes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
A
Verified Purchase
Angela Benton
Carnegie, US
★★★★★ 5
Will buy again
Color: Walnut, Size: 2 Pack
Great color, hardwear was easy to install, quality great, very stable, all in great fit great size and love the look
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026

recommand products